SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M3JQT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M3JQT5
Domain Number 1 Region: 9-51
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000128
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.003
Further Details:      
 
Domain Number 2 Region: 240-294
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000133
Family Motor proteins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M3JQT5
Sequence length 320
Comment (tr|A0A0M3JQT5|A0A0M3JQT5_ANISI) Uncharacterized protein {ECO:0000313|WBParaSite:ASIM_0001004401-mRNA-1} KW=Complete proteome; Reference proteome OX=6269 OS=Anisakis simplex (Herring worm). GN= OC=Ascaridoidea; Anisakidae; Anisakis; Anisakis simplex complex.
Sequence
MAAQASSADKYKVPAGLRPLLEALARETLRAQPTDLISFSQLFFQELQRHRDECGKEVDI
LKEPALYEKFKNDLQMKYQQQQQTTGTDNSPQEQPPRSQSPMDLAATKIQAAFRGHIVRA
NPEKFGLDKPEVVMQRRRSHEHIQVADTRKDLNEGAETERSELAKSSDDSDVPKTLDCSS
KKEIEDLKRDDDAAETANLNNPSTTDAADKMTTIQNRDNETDNSQHADVLGRHSVGGYTL
ERDTPEDRAATKIQAEIRGFLARKHVQSMRKEGDEAATKIQAHIRGFLTRKHLEETGVMS
PSHSHSSIKSSRSDDIDKDA
Download sequence
Identical sequences A0A0M3JQT5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]