SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M3JV01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M3JV01
Domain Number 1 Region: 211-304
Classification Level Classification E-value
Superfamily Cystatin/monellin 0.000000000000234
Family Cystatins 0.01
Further Details:      
 
Domain Number 2 Region: 65-132
Classification Level Classification E-value
Superfamily Cystatin/monellin 0.00000000638
Family Cathelicidin motif 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M3JV01
Sequence length 339
Comment (tr|A0A0M3JV01|A0A0M3JV01_ANISI) Uncharacterized protein {ECO:0000313|WBParaSite:ASIM_0001203201-mRNA-1} KW=Complete proteome; Reference proteome OX=6269 OS=Anisakis simplex (Herring worm). GN= OC=Ascaridoidea; Anisakidae; Anisakis; Anisakis simplex complex.
Sequence
MQVGSVVAIFLCALALIVSSQPWDGRYKKLDVNDEKIKVGFAASKYITFCKPLAHAQKYP
TQFQWSELANKAVEKSNEKSQFPSWHALKEIVSAKVQVGGTQNTVLELNLHPTNCKNEVP
KPKTECEMMKNTIGQFKEILFDEYIAINMQMKAVETGTSRLCAYENDRVASTKRYQSNSS
AKADIMHPYEVSVLILCLISIRKIQGDAEDGRKNEDVNDPIIQTLADRAVDQINKESKGD
YRSELIKIVSAKTQTINGKTTTLLLLTQRNYCPVSKSGRRKCFTLPTAFQRIYEIAVEYA
PMQTSQTPRMISSHKPPVIKVVRWIPSNGGSVSKSKCSK
Download sequence
Identical sequences A0A0M3JV01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]