SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M3QBI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0M3QBI2
Domain Number - Region: 4-19
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0366
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0M3QBI2
Sequence length 57
Comment (tr|A0A0M3QBI2|A0A0M3QBI2_LACPN) Uncharacterized protein {ECO:0000313|EMBL:KRN37493.1} KW=Complete proteome OX=1590 OS=Lactobacillus plantarum. GN=B0667_10510 OC=Lactobacillus.
Sequence
MADERPLNLVQFVADYFDTGTLNKALGALALCQEIKFYYTNSGLVSYLNIIFSLPVD
Download sequence
Identical sequences A0A0M3QBI2 A0A2I8UMS7 M4KN15
gi|556695158|ref|YP_008479741.1| gi|501147259|ref|YP_007987597.1| gi|448821865|ref|YP_007415027.1| WP_003645418.1.100103 WP_003645418.1.100379 WP_003645418.1.100429 WP_003645418.1.101934 WP_003645418.1.102085 WP_003645418.1.12236 WP_003645418.1.12549 WP_003645418.1.14222 WP_003645418.1.15471 WP_003645418.1.15989 WP_003645418.1.16633 WP_003645418.1.17136 WP_003645418.1.17377 WP_003645418.1.17979 WP_003645418.1.182 WP_003645418.1.19463 WP_003645418.1.19859 WP_003645418.1.20190 WP_003645418.1.21914 WP_003645418.1.22467 WP_003645418.1.25870 WP_003645418.1.26444 WP_003645418.1.27692 WP_003645418.1.28597 WP_003645418.1.28802 WP_003645418.1.29036 WP_003645418.1.29793 WP_003645418.1.31165 WP_003645418.1.3126 WP_003645418.1.33461 WP_003645418.1.34542 WP_003645418.1.34840 WP_003645418.1.35369 WP_003645418.1.36601 WP_003645418.1.37210 WP_003645418.1.37234 WP_003645418.1.37302 WP_003645418.1.37888 WP_003645418.1.37993 WP_003645418.1.39741 WP_003645418.1.4007 WP_003645418.1.40915 WP_003645418.1.40917 WP_003645418.1.42053 WP_003645418.1.42956 WP_003645418.1.4363 WP_003645418.1.44182 WP_003645418.1.44305 WP_003645418.1.47368 WP_003645418.1.48352 WP_003645418.1.48891 WP_003645418.1.49466 WP_003645418.1.49499 WP_003645418.1.49644 WP_003645418.1.49875 WP_003645418.1.52115 WP_003645418.1.52279 WP_003645418.1.53222 WP_003645418.1.54321 WP_003645418.1.54513 WP_003645418.1.56089 WP_003645418.1.56224 WP_003645418.1.56240 WP_003645418.1.56426 WP_003645418.1.56520 WP_003645418.1.57 WP_003645418.1.58100 WP_003645418.1.59824 WP_003645418.1.60366 WP_003645418.1.61917 WP_003645418.1.62691 WP_003645418.1.64492 WP_003645418.1.64570 WP_003645418.1.65354 WP_003645418.1.65378 WP_003645418.1.65980 WP_003645418.1.6617 WP_003645418.1.66243 WP_003645418.1.6836 WP_003645418.1.69461 WP_003645418.1.69847 WP_003645418.1.69852 WP_003645418.1.69983 WP_003645418.1.71366 WP_003645418.1.71807 WP_003645418.1.73311 WP_003645418.1.73499 WP_003645418.1.74718 WP_003645418.1.74868 WP_003645418.1.76182 WP_003645418.1.76397 WP_003645418.1.76549 WP_003645418.1.76699 WP_003645418.1.76771 WP_003645418.1.77336 WP_003645418.1.77712 WP_003645418.1.77972 WP_003645418.1.78824 WP_003645418.1.80520 WP_003645418.1.80904 WP_003645418.1.82268 WP_003645418.1.82388 WP_003645418.1.82602 WP_003645418.1.82735 WP_003645418.1.83366 WP_003645418.1.83620 WP_003645418.1.83647 WP_003645418.1.83777 WP_003645418.1.84028 WP_003645418.1.84419 WP_003645418.1.86479 WP_003645418.1.88099 WP_003645418.1.8813 WP_003645418.1.89420 WP_003645418.1.89637 WP_003645418.1.90117 WP_003645418.1.90208 WP_003645418.1.90426 WP_003645418.1.91137 WP_003645418.1.91351 WP_003645418.1.9149 WP_003645418.1.91683 WP_003645418.1.92145 WP_003645418.1.92629 WP_003645418.1.93143 WP_003645418.1.93409 WP_003645418.1.94656 WP_003645418.1.94667 WP_003645418.1.95302 WP_003645418.1.95345 WP_003645418.1.96838 WP_003645418.1.97246 WP_003645418.1.9731 WP_003645418.1.97443 WP_003645418.1.98090 WP_003645418.1.98401 WP_003645418.1.99274 WP_003645418.1.99945 YP_008479741.1.96219 gi|308181154|ref|YP_003925282.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]