SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M4CTL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M4CTL3
Domain Number 1 Region: 1-117
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 8.63e-20
Family CobE/GbiG C-terminal domain-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0M4CTL3
Sequence length 126
Comment (tr|A0A0M4CTL3|A0A0M4CTL3_SPHS1) Precorrin methylase {ECO:0000313|EMBL:ALC14628.1} KW=Complete proteome; Reference proteome OX=292913 OS=Sphingopyxis sp. (strain 113P3). GN=LH20_21915 OC=Sphingomonadaceae; Sphingopyxis.
Sequence
MIIAGFGFRSGVGLPSLRAAFALAEQGQPPVTHLATAQDKLAALLPLAEALGLPLMGVAS
DALAAVSTPTRSIASLNARHVGSVAEASALAAAGAGARLLSPRHISPDRMATCAIAASVN
LQGTPT
Download sequence
Identical sequences A0A0M4CTL3 A0A1W2DR33 A0A258GRI7 A0A2D8D279 Q2GBJ0
gi|87198360|ref|YP_495617.1| 279238.Saro_0335 WP_011443997.1.23047 WP_011443997.1.26809 WP_011443997.1.30798 WP_011443997.1.96002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]