SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M4EP55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M4EP55
Domain Number 1 Region: 161-212
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0000000000000209
Family Fibrinogen C-terminal domain-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0M4EP55
Sequence length 212
Comment (tr|A0A0M4EP55|A0A0M4EP55_DROBS) Maker409 {ECO:0000313|EMBL:ALC38307.1} KW=Complete proteome; Reference proteome OX=30019 OS=Drosophila busckii (Fruit fly). GN=Dbus_chr2Lg392 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
MRPNTATDVMSCPAARESNEDCRSYCYKVVKPLLQYFRISAEKNDQFEKLQQQEAKIKSL
ESKANANKEALSNCSEDKLKAEKKTLKLQTKITELQKKLAEQKEALKKSDKLKDSLMNEK
DKHIAQIEEQMNCMEHENKLLKDELTKQKDRAEATSCLPFGNSSDIQTLHLPGVNAFQVP
CDSKFAGNGWVVIQRRVDGSVNFNQTLEEYRN
Download sequence
Identical sequences A0A0M4EP55

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]