SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M4GKZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M4GKZ7
Domain Number 1 Region: 145-203
Classification Level Classification E-value
Superfamily R3H domain 0.00000000012
Family R3H domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M4GKZ7
Sequence length 205
Comment (tr|A0A0M4GKZ7|A0A0M4GKZ7_9BACI) Protein jag {ECO:0000313|EMBL:ALC88515.1} KW=Complete proteome; Reference proteome OX=1705566 OS=Bacillus sp. FJAT-18017. GN=AM500_00945 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MKQITASGQTVEDAVQSALAQLNTTKERTDVEIVDEGKKGIFGFGSRPAIVKVTVRIDPL
EEARKFLYQVAEQMGAPIEIETIKDGKHVTFVLSGEKIALLIGKRGQTLNSLQYLTQLVL
NRFSEQYLTVILDAEDYRNRRNETLIQLAQRLAQKAVKTGKNVTLEPMPSYERKVIHTAL
SENTKVKTYSDGTEPHRHIVISPIR
Download sequence
Identical sequences A0A0M4GKZ7
WP_053597524.1.69542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]