SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M4QHQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M4QHQ8
Domain Number 1 Region: 151-193
Classification Level Classification E-value
Superfamily R3H domain 0.000000000102
Family R3H domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M4QHQ8
Sequence length 195
Comment (tr|A0A0M4QHQ8|A0A0M4QHQ8_9MICC) RNA-binding protein {ECO:0000313|EMBL:ALE93380.1} KW=Complete proteome; Reference proteome OX=656366 OS=Arthrobacter alpinus. GN=AOC05_15375 OC=Bacteria; Actinobacteria; Micrococcales; Micrococcaceae; Arthrobacter.
Sequence
MPAETGIVPEQTVDQDNAVRAGAEQDNVDPVLVDQDDASGANRLEEEGDIAADYLEELLD
IADIDGDIDIEVRNGRTYISIVADEEVVSLKALVGQDGEVLDALQELTRLSVLSATENRS
RLVLDIDGYRDRRNVELAQIAKDAAAAIKAGSVSVALEPMGAYERKIVHDTIAELGLESE
SEGEGASRHIVVTAS
Download sequence
Identical sequences A0A0M4QHQ8
WP_062008098.1.101966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]