SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M4SMA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M4SMA2
Domain Number 1 Region: 70-419
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.95e-94
Family Ankyrin repeat 0.0000132
Further Details:      
 
Domain Number 2 Region: 3-68
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000837
Family Pseudo ankyrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M4SMA2
Sequence length 425
Comment (tr|A0A0M4SMA2|A0A0M4SMA2_9NOSO) Ankyrin {ECO:0000313|EMBL:ALF54185.1} KW=Complete proteome; Reference proteome OX=224013 OS=Nostoc piscinale CENA21. GN=ACX27_17225 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MTENNDVLLLKAAKSGDIKRLSEILAAGVNIDACDRDGTTALMYAANLGYTEIVRSLLDA
GANINLPRKRYGLTALMLAASNKQIDIVQLLISRGADVNAINEDGSTALMAAALKGYTEI
VQILLAAGAKVNIADKDDDTALKLAVKQEHPAIVQLLAQNGADVNLQDEDGETLLMIAAD
VGNLAIVQALLGAGADINLQNSDGGTALLAAAAAGNSAIASALLDKDAQINLQDKDGETA
LHIAVVEGHLEVVKVLLNRGANVQIRNNLGDTPILVSVLQGHSEILEALLRSSANSYGEL
EIPLMAAISLGHTKTVQVLLDYGANPNTLGNDSQTALLKAAKRNQIEIIQLLLAKGANVN
FQDIAGATALMWAASGGYTETVQILLKAGANPNLRNRGGYTALMLAEFNGYQDIVKLLQT
AGAQE
Download sequence
Identical sequences A0A0M4SMA2
WP_062294698.1.4589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]