SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M5J2Z5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M5J2Z5
Domain Number 1 Region: 31-97
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000228
Family Tachycitin 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0M5J2Z5
Sequence length 122
Comment (tr|A0A0M5J2Z5|A0A0M5J2Z5_DROBS) CG5756 {ECO:0000313|EMBL:ALC42148.1} KW=Complete proteome; Reference proteome OX=30019 OS=Drosophila busckii (Fruit fly). GN=Dbus_chr2Rg1727 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
DKSSDYTDQQFDLRHTIPGTPGVDYPILSVVPQTSFVCNQRHEGYYADVESRCQAFRICA
HTARSPQGFGFLCPNGTIFSQQKFVCDWYRNVNCDESERYYDMNRDNVVGDMQQMMERVR
QM
Download sequence
Identical sequences A0A0M5J2Z5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]