SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M5JC57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M5JC57
Domain Number 1 Region: 13-57
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000837
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0037
Further Details:      
 
Domain Number 2 Region: 180-253
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000345
Family Motor proteins 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M5JC57
Sequence length 411
Comment (tr|A0A0M5JC57|A0A0M5JC57_DROBS) CG10014 {ECO:0000313|EMBL:ALC45794.1} KW=Complete proteome; Reference proteome OX=30019 OS=Drosophila busckii (Fruit fly). GN=Dbus_chr3Rg544 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
MNYLIQRGKARQQAINVPDGFPELLSDITREVLRCQPTKECLCQFIIDYLHSLIVTREKA
MVAKSILDRALRQVDSIISDLCVCELSQEKSEMMASVMEECFRNFLEKRRCEMRRGKEAI
KFADIDMLSELLEKCKFSEEELDSSRPAIESAYKRFVDAYMAAATESQGTELLYQYFRDR
ELKRIDEMMRNQAAITIQAAFRGYIVRRTMALHVCTCTCMMDDEEDEETKRQDAAARIIQ
RFFRWVMARQAIKPIDDPCVDKETPPSKDDGSSPPTLAVESAAEVAPAAAESAAAVGAEA
SGEAAADEAEPAAAVAEEAAPAAAAAATEEAAPAAAEPAAAEAPAEAAPEAAAEAPPEAA
APAAAEEAAAPAAAEEPAPAAPAEEPAPAPPAEEAPPAAEAEPPAAEAPAE
Download sequence
Identical sequences A0A0M5JC57
XP_017845381.1.30616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]