SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M5N4N4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0M5N4N4
Domain Number - Region: 5-100
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.00844
Family Fibrinogen coiled-coil and central regions 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M5N4N4
Sequence length 124
Comment (tr|A0A0M5N4N4|A0A0M5N4N4_9STAP) Uncharacterized protein {ECO:0000313|EMBL:BAS46631.1} KW=Complete proteome OX=1295 OS=Staphylococcus schleiferi. GN=SSCHL_1851 OC=Staphylococcus.
Sequence
MDEIKKIKQEIADLTERVDSIEQTANEAASHVVSLRKEYRNGHQELQESHKELKDKQEKV
VNENFEQTKILNRIEERYQTQVEVAQNNEGKTLALNKWLVGAIWALVTIVMIVVITASIN
ALIP
Download sequence
Identical sequences A0A0M5N4N4 A0A1J0MFD0 A0A2I0XRV3 A0A2K3XBE1
WP_015728845.1.34305 WP_015728845.1.48674 WP_015728845.1.74935 WP_015728845.1.98064 gi|319891886|ref|YP_004148761.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]