SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M6YKJ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M6YKJ9
Domain Number 1 Region: 22-103
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.000000314
Family Intein (protein splicing domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M6YKJ9
Sequence length 188
Comment (tr|A0A0M6YKJ9|A0A0M6YKJ9_9RHOB) Uncharacterized protein {ECO:0000313|EMBL:CTQ50424.1} KW=Complete proteome; Reference proteome OX=420998 OS=Jannaschia donghaensis. GN=JDO7802_02448 OC=Rhodobacteraceae; Jannaschia.
Sequence
MSDQRIFTHDAFPVIAPIALRFTPGTCLATPDGPRAVETLIVGDPVDTRDGPKRIARLDV
VRRPRSEWTYDRDAWPIRVPVGSLGNARPMRLSPDQRILLSGDTVARVCAVREISVALRD
LIGLRGLIGERPLADLRYHGLSFGIPAVIEAEGVPCEIEAGDAAIVAQEMARAAFQEMHA
AGEPPLKR
Download sequence
Identical sequences A0A0M6YKJ9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]