SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M6ZX16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M6ZX16
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase II 1.15e-45
Family Peptidyl-tRNA hydrolase II 0.00000301
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M6ZX16
Sequence length 135
Comment (tr|A0A0M6ZX16|A0A0M6ZX16_9RHOB) Uncharacterized protein {ECO:0000313|EMBL:CTQ66722.1} KW=Complete proteome OX=388408 OS=Labrenzia alexandrii. GN=LAX5112_01069 OC=Rhodobacteraceae; Labrenzia.
Sequence
MFDTKFVIVVREDLAMWQKLNVTAFLSTGVAAAKPDIIGMPYQDADGNVYHPMSVQPVIV
LTANPDALKKIHRRTLERQVKSSLYIEEMFSTGHDSANRAVFAEHTPDGAKVVGIAFHTD
KKTADKISKGAKMHG
Download sequence
Identical sequences A0A0M6ZX16 B9QUZ8
WP_008196721.1.19687 WP_008196721.1.6957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]