SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M6ZYN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0M6ZYN4
Domain Number - Region: 5-76
Classification Level Classification E-value
Superfamily MukF C-terminal domain-like 0.0353
Family MukF C-terminal domain-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0M6ZYN4
Sequence length 78
Comment (tr|A0A0M6ZYN4|A0A0M6ZYN4_9RHOB) Uncharacterized protein {ECO:0000313|EMBL:CTQ67326.1} KW=Complete proteome OX=388408 OS=Labrenzia alexandrii. GN=LAX5112_01331 OC=Rhodobacteraceae; Labrenzia.
Sequence
MSYAEQIKSLFPEDWPIVLENCAADPEIEEICSDLARLAQDLETAEDNIAFMSSNLKQDV
LKTMKALAQEIRQKLDLS
Download sequence
Identical sequences A0A0M6ZYN4 B9QTQ1
WP_008188914.1.19687 WP_008188914.1.6957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]