SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M8M9H5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M8M9H5
Domain Number 1 Region: 10-99
Classification Level Classification E-value
Superfamily S-adenosylmethionine decarboxylase 1.61e-16
Family Bacterial S-adenosylmethionine decarboxylase 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0M8M9H5
Sequence length 121
Comment (tr|A0A0M8M9H5|A0A0M8M9H5_9FLAO) Adenosylmethionine decarboxylase {ECO:0000256|SAAS:SAAS00951950} KW=Complete proteome; Reference proteome OX=1202724 OS=Flavobacterium akiainvivens. GN=AM493_10030 OC=Flavobacteriaceae; Flavobacterium.
Sequence
MNTQHTYSPGLHKLLTLKIVKPQLLTNAEAFKRFTNGLMLQYGLEEVGYSVHTFPNGSFT
AAVCLAESHICIHTWPEFNQLTLDVYLCNYLQDNSAKVRGVAGAYIDYFEAEILNDTEIN
R
Download sequence
Identical sequences A0A0M8M9H5
WP_054407834.1.85475 WP_054407834.1.9242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]