SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M8MNL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M8MNL4
Domain Number 1 Region: 73-178
Classification Level Classification E-value
Superfamily GINS helical bundle-like 5.02e-29
Family PSF2 C-terminal domain-like 0.00085
Further Details:      
 
Domain Number 2 Region: 13-71
Classification Level Classification E-value
Superfamily PriA/YqbF domain 0.0000000000000034
Family PSF2 N-terminal domain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0M8MNL4
Sequence length 203
Comment (tr|A0A0M8MNL4|A0A0M8MNL4_9BASI) DNA replication complex GINS protein PSF2 {ECO:0000256|PIRNR:PIRNR028998} KW=Complete proteome; Reference proteome OX=77020 OS=Malassezia pachydermatis. GN=Malapachy_2325 OC=Malasseziomycetes; Malasseziales; Malasseziaceae; Malassezia.
Sequence
MALPPPTRYGILPTEMEYVAGTETLVDILPLISLDRVRLLSGTYGPFQPPTHAQVPLWLA
VSLRKKRKCVIIPPAWLSVDALTEFLRQETTQLAFAPLPLHYVAISKMLLEHAAEDIPAS
SRIRALLKDLRETRQSKVLAGLEMLNPAHLEMTNISSMEICEVRPFFQTALNQLHAIQGT
DTTKEEPPSQTIEDDGEVSVRRV
Download sequence
Identical sequences A0A0M8MNL4
XP_017992820.1.46905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]