SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M8RQN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M8RQN9
Domain Number 1 Region: 17-169
Classification Level Classification E-value
Superfamily Hypothetical protein YwqG 0.00000942
Family Hypothetical protein YwqG 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M8RQN9
Sequence length 183
Comment (tr|A0A0M8RQN9|A0A0M8RQN9_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:KOU08835.1} KW=Complete proteome OX=1519475 OS=Streptomyces sp. NRRL F-5755. GN=ADK86_02820 OC=Streptomyces.
Sequence
MLLIYGGEAVADEPVLRTGGVPLVPDGFVWPTCRECEGAMQFLAHLPVEGGAIAVFQCQN
DPGMCGDWDATGGANRAFLFTGRLAAAKVPAEGETLLGAVTALRIHPEDTPTDERALGRL
GGEPDWIQHDETPDCPSCATRMTFTAQLEEGYDHRTAANFGGMGRGYVFRCRGCGEAAFL
WQC
Download sequence
Identical sequences A0A0M8RQN9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]