SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M8W3V8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M8W3V8
Domain Number 1 Region: 73-193
Classification Level Classification E-value
Superfamily Cyclophilin-like 2.5e-40
Family PH0987 C-terminal domain-like 0.000021
Further Details:      
 
Domain Number 2 Region: 4-77
Classification Level Classification E-value
Superfamily PH0987 N-terminal domain-like 0.00000248
Family PH0987 N-terminal domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0M8W3V8
Sequence length 195
Comment (tr|A0A0M8W3V8|A0A0M8W3V8_9NOCA) Allophanate hydrolase {ECO:0000313|EMBL:KOV75483.1} KW=Complete proteome; Reference proteome OX=1519492 OS=Nocardia sp. NRRL S-836. GN=ADL03_44300 OC=Bacteria; Actinobacteria; Corynebacteriales; Nocardiaceae; Nocardia.
Sequence
MLLRRCGTDALLVEVDSLTEVAAVRAALHGLPGVEELVPAARTVLVKGALPQVREVLKTV
DLTSAPAAESRQVTIPVSYDGPDLDLVARTAGISAEEVVELHTGATYEVAFCGFAPGFGY
LTGLPAQLQQPRLDSPRTKVPAGSVGIAGEFTAAYPRATPGGWRLIGRTEITLFDPGSET
PALLAPGDVVRFVVA
Download sequence
Identical sequences A0A0M8W3V8
WP_053739619.1.22279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]