SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M8XYX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M8XYX8
Domain Number 1 Region: 13-148
Classification Level Classification E-value
Superfamily BH3703-like 1.57e-25
Family BH3703-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0M8XYX8
Sequence length 152
Comment (tr|A0A0M8XYX8|A0A0M8XYX8_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:KOX13961.1} KW=Complete proteome; Reference proteome OX=1519494 OS=Nocardiopsis sp. NRRL B-16309. GN=ADL05_16990 OC=Nocardiopsis.
Sequence
MNSFKRGHLDPTEQYEILHSIGLDLLGAAPEGWHEITFKVSSLITGSENDMIVEFENGEA
QRKRFPHTVISKFVELRAGMYQEGKGTWFSMIYKIVRPGTFTTEFNYDNPAPYDLLPGAE
SFATDLNYFPRDPEHIPDWLQQKLREAETEQD
Download sequence
Identical sequences A0A0M8XYX8
WP_053617941.1.38893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]