SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M9C8N7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M9C8N7
Domain Number 1 Region: 56-142,173-223
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 2.22e-21
Family Band 7/SPFH domain 0.02
Further Details:      
 
Weak hits

Sequence:  A0A0M9C8N7
Domain Number - Region: 212-300
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 0.0144
Family Tex N-terminal region-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0M9C8N7
Sequence length 326
Comment (tr|A0A0M9C8N7|A0A0M9C8N7_VIBPH) Protein HflC {ECO:0000256|PIRNR:PIRNR005651} KW=Complete proteome OX=670 OS=Vibrio parahaemolyticus. GN=ACX03_07435 OC=Vibrionaceae; Vibrio.
Sequence
MRKLMIPVLVIALALMLMSLFVIPEGERGIVVRFGRVLKDNNDITRIYEPGLHFKMPLFD
RVKQLDARIQTMDGRADRFVTSEKKDVIIDTYVKWRIEDFGRYYLATGGGNSLTAEALLE
RKVTDVLRSEIGAREIKQIVSGPRNDDVLPEDASADVVATEAAREALEIDGERDLIMSEV
LKDTRESAMKDLGVRVVDFRMKKINLPDEISESIYRRMRAERESVARKHRSQGREKAEVI
RAQAELEVATILAEADKTARVTRGEADAEAAKIYAEAYNKDPEFFSFLRSLRAYEKSFSS
KSDILVLDPKSEFFQYMNQSKGGMEK
Download sequence
Identical sequences A0A034U0J6 A0A0M9C8N7 A0A0T7EH05 A0A2K7SMQ8 A7K574
gi|262393036|ref|YP_003284890.1| 150340.VEA_002262 WP_005395373.1.10903 WP_005395373.1.18397 WP_005395373.1.25443 WP_005395373.1.3237 WP_005395373.1.36366 WP_005395373.1.43605 WP_005395373.1.75998 WP_005395373.1.82618 WP_005395373.1.98725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]