SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M9G0V4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M9G0V4
Domain Number 1 Region: 25-70
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000016
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0071
Further Details:      
 
Domain Number 2 Region: 70-153
Classification Level Classification E-value
Superfamily EF-hand 0.000017
Family Calmodulin-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M9G0V4
Sequence length 167
Comment (tr|A0A0M9G0V4|A0A0M9G0V4_9TRYP) Uncharacterized protein {ECO:0000313|EMBL:KPA80055.1} KW=Complete proteome; Reference proteome OX=157538 OS=Leptomonas pyrrhocoris. GN=ABB37_05070 OC=Leishmaniinae; Leptomonas.
Sequence
MFAVADPDAVTASPPADAATVDSPQRTRQYIHDHKLNELFAHLLQLVLYHKPENPRVFLA
DEVHRIRSEKVSSSLFTEKDLETMFEMIDVTSQKWITVQQLRNTCRNLSTGSSGTERGGN
GAVNTLSEEQEAAITRAGDAAGHVSLEKFKEVLASLLLTRNMWSAKE
Download sequence
Identical sequences A0A0M9G0V4
XP_015658494.1.39912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]