SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M9VXA8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M9VXA8
Domain Number 1 Region: 6-178
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 7.46e-25
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00047
Further Details:      
 
Domain Number 2 Region: 367-477
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000157
Family Pseudo ankyrin repeat 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0M9VXA8
Sequence length 569
Comment (tr|A0A0M9VXA8|A0A0M9VXA8_9HYPO) Uncharacterized protein {ECO:0000313|EMBL:KOS22983.1} KW=Complete proteome; Reference proteome OX=150374 OS=Escovopsis weberi. GN=ESCO_003790 OC=Escovopsis.
Sequence
MPVRNRKLRLLVAAAGPRDTSWAQALVIRFSKNPDIEMRAIVDDVVPRLAQTIIVMQNFG
LTPGPGDRADDVEFYRQQAYDLVQWADLLVCVPLDADGIAKMLAGVADTFLGEVLRGWDS
QKVIILVPGMSTHMWANPLTKRQLGKIRRKWGWVRALPPILWHYEGSPNPKRVPNWNGFN
DVLGIIKNQAELLGLGRDVDIGPGSGASAAPEADARVRTKLPPEIWTIIFDLSGDWELAK
AMGVYTTLPAPGPWTLQPKDPGNALQVYEHELEWTALTGSPGSVCRKLSQAPTSFQDLPA
LVVKMVIRFGLVEVLAYLEANRPDLFRAFEGTILPTKASAYYARTEVLDYWRQSAFFRDK
HAYEAEAVDGASKNGHVRVLDWWWQRSGLPMRYTEGALEQASAKGHLHVLEWWRDAAAQD
EGIVLRPGRSLLFATQNGRAEVLRWWEASGIPLGHGEAIPKVASRWGRVECLELWRRMKG
DDKLVFDEEVLVTSTMHQHIDILEWWRRYAHGELPGMDGPAQKVEFRTCNIEEALEDTYG
DQSRVREWWVQNGLNLGLRNEEWLQARCL
Download sequence
Identical sequences A0A0M9VXA8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]