SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N0BP07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N0BP07
Domain Number 1 Region: 21-58
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000101
Family TSP type-3 repeat 0.007
Further Details:      
 
Domain Number 2 Region: 187-233
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000733
Family Matrix metalloproteases, catalytic domain 0.06
Further Details:      
 
Domain Number 3 Region: 140-243
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000617
Family Matrix metalloproteases, catalytic domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0N0BP07
Sequence length 279
Comment (tr|A0A0N0BP07|A0A0N0BP07_9EURY) Uncharacterized protein {ECO:0000313|EMBL:KOX93236.1} KW=Complete proteome OX=1705562 OS=Haloarcula rubripromontorii. GN=AMS69_11915 OC=Haloarcula.
Sequence
MNTTSGGGADTPSRQQVQAGPNATDTDGDGLADSLERSVYHTNPAKADTDGDGYPDGMEV
RCEQAIPDADPLRTDIYVEVDSTESTTLSEPVQTSIVETFAEAPVSNPDGSTGIDIHLAT
DDTNLSANGTVYSKSRAGAGNDIYDFRANHSQHRSDGYYYVLLTDDVAYNGDDYYVGAGR
PEVAAMERFDSTKITASLFMHEFGHAMGLDAHQDGIDEERYSRTEYDSVMNYNGLYRQLT
YSNGTDSVGRNEWQFVAENRTQPDVACAENACASRCTQD
Download sequence
Identical sequences A0A0N0BP07
WP_053968366.1.78115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]