SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N0F7R2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0N0F7R2
Domain Number - Region: 43-97
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00667
Family Pseudo ankyrin repeat 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0N0F7R2
Sequence length 269
Comment (tr|A0A0N0F7R2|A0A0N0F7R2_PSEYM) Uncharacterized protein {ECO:0000313|EMBL:KPB68834.1} KW=Complete proteome OX=59511 OS=Pseudomonas syringae pv. maculicola. GN=AC507_1873 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MEAEQVWKLWRRVLRDERLQAQLFSATDATHWLSGFSESESKILSVYAQQFDRVKWFVEN
YQFRLVNSFLNALETGAPLSLRALLHINVDLNAQSKAFLRDRQWRDYGPQVYTYCEDVLG
FLAEADELQGYPEILDLMRLERESVRLYRGLVDPESLPADNRYQRTSMARLYETRFALSG
WLRQKDQLGLTRLPESTEHVLIYLPTLQARHKFTLINAQAARLYNCLEQPQSAAGLFMLI
NSDSASVPGSADLALLDRLEQLNAIRKPL
Download sequence
Identical sequences A0A0N0F7R2 F3HQJ0
WP_007252216.1.52488 WP_007252216.1.93459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]