SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N0G601 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N0G601
Domain Number 1 Region: 1-156
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase catalytic, N-terminal domain 3.66e-48
Family Glutamyl tRNA-reductase catalytic, N-terminal domain 0.00043
Further Details:      
 
Domain Number 2 Region: 160-313
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.69e-34
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00021
Further Details:      
 
Domain Number 3 Region: 316-416
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 3.01e-25
Family Glutamyl tRNA-reductase dimerization domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0N0G601
Sequence length 425
Comment (tr|A0A0N0G601|A0A0N0G601_PSEYM) Glutamyl-tRNA reductase {ECO:0000256|HAMAP-Rule:MF_00087, ECO:0000256|RuleBase:RU000584, ECO:0000256|SAAS:SAAS00640036} KW=Complete proteome OX=59511 OS=Pseudomonas syringae pv. maculicola. GN=AC503_0252 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MAFLALGINHKTASVDVRERVAFTPEQLVDALQQLCHLTESREAAILSTCNRSELYIEHE
HLGADSILAWLANYHHLSLEELRASAYVHEDDAAVRHMMRVASGLDSLVLGEPQILGQMK
SAYAVAREAGTVGPLLGRLFQATFSAAKQVRTDTAIGENPVSVAFAAVSLAKQIFSDLQR
SQALLIGAGETITLVARHLHDLGVKRIVVANRTLERASILAAEFGAHAVLLSDIPAELVN
SDIVISSTASQLPILGKGAVESALKLRKHKPIFMVDIAVPRDIEPEVGELDDVYLYSVDD
LHEVVAENLKSRQGAALAAEQLVSVGAEDFMSRLRELAAVDVLRAYRQQSERLRDEELSK
AQRMLANGSNAEDVLIQLARGLTNKLLHAPSVQLKKLSAEGRVDALAMAQELFALGEGST
DKTPQ
Download sequence
Identical sequences A0A099SV09 A0A0N0G601 A0A0P9LGG8 A0A0P9QPD3 A0A0Q0CHU2 A0A1H3J6Q4 F3IM13 K2T1M7 Q888C2
223283.PSPTO_1108 gi|28868323|ref|NP_790942.1| NP_790942.1.37326 WP_005615192.1.12126 WP_005615192.1.14276 WP_005615192.1.14773 WP_005615192.1.14805 WP_005615192.1.17870 WP_005615192.1.19985 WP_005615192.1.23747 WP_005615192.1.26792 WP_005615192.1.28009 WP_005615192.1.31812 WP_005615192.1.41250 WP_005615192.1.45653 WP_005615192.1.45809 WP_005615192.1.58347 WP_005615192.1.60779 WP_005615192.1.60793 WP_005615192.1.62491 WP_005615192.1.64333 WP_005615192.1.6959 WP_005615192.1.69804 WP_005615192.1.71514 WP_005615192.1.7265 WP_005615192.1.73412 WP_005615192.1.74733 WP_005615192.1.80269 WP_005615192.1.83999 WP_005615192.1.87092 WP_005615192.1.87724 WP_005615192.1.88146 WP_005615192.1.89893 WP_005615192.1.92774 WP_005615192.1.99297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]