SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N0I4V4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N0I4V4
Domain Number 1 Region: 4-81
Classification Level Classification E-value
Superfamily YugE-like 6.02e-24
Family YugE-like 0.00000791
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0N0I4V4
Sequence length 87
Comment (tr|A0A0N0I4V4|A0A0N0I4V4_9BACI) Uncharacterized protein {ECO:0000313|EMBL:KPC98039.1} KW=Complete proteome; Reference proteome OX=1547578 OS=Geobacillus sp. BCO2. GN=LR69_03726 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
Sequence
MAGQQLNRLLLEWIGAWDPFGLGKDAYDVEAASVLQAVYETEDARALAARIQSIYEFAFD
EPIPFLHCLKLARRLLELKQAASCSLP
Download sequence
Identical sequences A0A0J0V7J1 A0A0N0I4V4 A0A226Q9R3
WP_025949994.1.57889 WP_025949994.1.65208 WP_025949994.1.86012 WP_025949994.1.9165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]