SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N0NNX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N0NNX0
Domain Number 1 Region: 1-149
Classification Level Classification E-value
Superfamily LigT-like 4.19e-17
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N0NNX0
Sequence length 212
Comment (tr|A0A0N0NNX0|A0A0N0NNX0_9EURO) 2',3'-cyclic-nucleotide 3'-phosphodiesterase {ECO:0000313|EMBL:KPI41869.1} KW=Complete proteome; Reference proteome OX=1664694 OS=Phialophora attae. GN=AB675_5669 OC=Phialophora.
Sequence
MTASLWLVPRENNPFTKTTIELITETVPSNFVSLLEGKKVNFEPHVTVTSDIDASKYGDK
PQEWLDSLSLPEFKKEVNDLVLEMDEVEADDPYFRKLTIKLLKNDNLIKLAAQCRADAVD
SESAQKWAETEYSPHLSLMYADIPRAEVKKKVPLIEMQIAYAIGDLFACCGGTLCMGGYL
VLVDTSKPVDEWKTIAKRETPWAMWKMTRNMI
Download sequence
Identical sequences A0A0N0NNX0
XP_018001832.1.2460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]