SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N0P829 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N0P829
Domain Number 1 Region: 202-258
Classification Level Classification E-value
Superfamily BAG domain 0.00000883
Family BAG domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N0P829
Sequence length 282
Comment (tr|A0A0N0P829|A0A0N0P829_LEPSE) Uncharacterized protein {ECO:0000313|EMBL:KPI89037.1} KW=Complete proteome; Reference proteome OX=5684 OS=Leptomonas seymouri. GN=ABL78_1850 OC=Leishmaniinae; Leptomonas.
Sequence
MWAAWTSSLPWSSSTTTTTKSAGAADYTSSAAATSASLPSVAPPVSHLPQWRLFSTVSRQ
ISRRWSHASPQSVRRAVAAAAAVTALIGAVAVARGACRRSSSCSTQSGGGRGEALCPSTQ
VGADANTQAEEECMSAVVKGRNDNDSGGADDIQFADPAVSAFNAYVRRIKRQKESVLLSA
IAQLESAAAELKASQSSAEETSAESTEEEGKVAQLQAKVYRAAVVADELLTQWICSLDGV
PVRQREDLKQRRKELVQSAAVLSQRIAPHLHPIPSVPAQEAQ
Download sequence
Identical sequences A0A0N0P829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]