SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N0RC01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N0RC01
Domain Number 1 Region: 21-113
Classification Level Classification E-value
Superfamily YccV-like 7.19e-33
Family YccV-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0N0RC01
Sequence length 124
Comment (tr|A0A0N0RC01|A0A0N0RC01_9SPHN) Uncharacterized protein {ECO:0000313|EMBL:GAO78802.1} KW=Complete proteome OX=262667 OS=Sphingopyxis sp. C-1. GN=SC1_02113 OC=Sphingomonadaceae; Sphingopyxis.
Sequence
MTPDSSSELPAAVTAPLIGRARFAPGDIVRHRMFDFRGVVFDIDPVFANSDEWYEAIPED
IRPAKEQPYYHLLAENGDSSYIAYVSQQNLVADGDGGPIDHPQIDAMFEGLDHGRYRVRA
IHRH
Download sequence
Identical sequences A0A0N0RC01
WP_062181000.1.14937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]