SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N0S8R2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N0S8R2
Domain Number 1 Region: 110-154
Classification Level Classification E-value
Superfamily R3H domain 0.0000000000159
Family R3H domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0N0S8R2
Sequence length 155
Comment (tr|A0A0N0S8R2|A0A0N0S8R2_STRRM) Single-stranded DNA-binding protein {ECO:0000313|EMBL:KOT82968.1} KW=Complete proteome OX=1464079 OS=Streptomyces rimosus subsp. pseudoverticillatus. GN=ADK70_24215 OC=Streptomyces.
Sequence
MTRLEQEGEIAADYLEGLLDIADLDGDIDMDVEADRAAVSIISDSTSRDLQKLVGRDGEV
LEALQELTRLAVHRETGDRSRLMLDIAGFRARKREELAELGAKAAEEAKGTGEPVKLKPM
TPFERKVVHDAVAAAGLRSESEGEEPQRCVVVLPA
Download sequence
Identical sequences A0A0M8QQ26 A0A0M9XTC5 A0A0N0S8R2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]