SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N0U1L5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N0U1L5
Domain Number 1 Region: 19-142
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 1.96e-28
Family CobE/GbiG C-terminal domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0N0U1L5
Sequence length 149
Comment (tr|A0A0N0U1L5|A0A0N0U1L5_9ACTN) Precorrin methylase {ECO:0000313|EMBL:KOX59565.1} KW=Complete proteome OX=53367 OS=Asanoa ferruginea. GN=ADL14_10985 OC=Asanoa.
Sequence
MAPRHAGDPVGLDQAVTGALVAGIGFRRETDAEEIAGLIERALALAGAARSSLAAVATAA
DRASDPAIRAAAARFGLAPHPVPAAALEARDAEIVTRSARIEHLRGVGSLAEAAALAGAG
DMSRLALPRIASRGATCALAVRYDTTREP
Download sequence
Identical sequences A0A0N0U1L5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]