SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N0ZEB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N0ZEB3
Domain Number 1 Region: 8-192
Classification Level Classification E-value
Superfamily VC0467-like 1.3e-63
Family VC0467-like 0.00000367
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N0ZEB3
Sequence length 192
Comment (tr|A0A0N0ZEB3|A0A0N0ZEB3_9BURK) UPF0301 protein ADM96_32535 {ECO:0000256|HAMAP-Rule:MF_00758} KW=Complete proteome; Reference proteome OX=1682204 OS=Burkholderia sp. ST111. GN=ADM96_32535 OC=Burkholderiaceae; Burkholderia.
Sequence
MSKSTDRINLTNQFLIAMPSMADPTFSGTVVYLCDHSERGALGLVINRPTDIDLEALFSR
IDLKLEIEPLLHVPVYFGGPVQTERGFVLHDPKDGNAYTSSMSVPGGLEMTTSKDVLEAV
ASGTGPERFLLTLGHAGWGAGQLEEEISKNGWLTVEADPKIVFDVPAEERLEAALALLGI
SLSMLSGEAGHA
Download sequence
Identical sequences A0A0N0ZEB3 A0A1I7DYI3
WP_054041678.1.22769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]