SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N1BD00 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N1BD00
Domain Number 1 Region: 11-100
Classification Level Classification E-value
Superfamily AF2212/PG0164-like 0.00000000000000128
Family PG0164-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0N1BD00
Sequence length 104
Comment (tr|A0A0N1BD00|A0A0N1BD00_9PROT) Uncharacterized protein {ECO:0000313|EMBL:KPF73194.1} KW=Complete proteome; Reference proteome OX=1523432 OS=alpha proteobacterium AAP81b. GN=IP88_09705 OC=Bacteria; Proteobacteria; Alphaproteobacteria.
Sequence
MNGGGPVLARIAFDAEIIVWRGPAPFLFAPVPPDLIDEIRAAARLASYGWGVVPVAARIG
ATAFSTSLFPRDRGYLLPIKVAVQRAEAIGAGDHIHAVIQIAAR
Download sequence
Identical sequences A0A0N1BD00
WP_054129034.1.31302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]