SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N1DT97 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N1DT97
Domain Number 1 Region: 26-120
Classification Level Classification E-value
Superfamily TIMP-like 0.0000000000314
Family Tissue inhibitor of metalloproteinases, TIMP 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N1DT97
Sequence length 151
Comment (tr|A0A0N1DT97|A0A0N1DT97_9RHIZ) Uncharacterized protein {ECO:0000313|EMBL:KPH07859.1} KW=Complete proteome OX=1538158 OS=Rhizobium acidisoli. GN=AOG23_15905 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MNSYRVAVLIAASALLALSDTQASACSCKEMSTKESFASSDLVVRGRMKLVTYGVEVPGG
GSDGETIRMTRGEFEIQKVLKGTFKGKNLSMYTGSGMGDCGRLGEFLASAINYSDKKFVV
EFGLSKAEHAGQTLYFTSICDYIKGPKDGQQ
Download sequence
Identical sequences A0A0N1DT97
WP_054183478.1.46073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]