SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N1GQV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N1GQV5
Domain Number 1 Region: 36-148
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 1.44e-16
Family Lamin A/C globular tail domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0N1GQV5
Sequence length 172
Comment (tr|A0A0N1GQV5|A0A0N1GQV5_9ACTN) Intermediate filament domain protein {ECO:0000313|EMBL:KPI26724.1} KW=Complete proteome; Reference proteome OX=1592329 OS=Actinobacteria bacterium OV320. GN=OV320_6393 OC=Bacteria; Actinobacteria.
Sequence
MSTSASVTARRLTAATLTAGALVGAMALPASASDHARPHRPEVRISAVQYDAPGRDDRSR
SSLNREWVELTNTTRHTINLDGWTLKNEDGRTYTFHHYRLEGRSTVRVHTGEGRDTRRDL
FQDRYKEVWDNRSDTATLRNDHGRFVDDESWGRNRHHDGGHHNGGHHDGNRH
Download sequence
Identical sequences A0A0N1GQV5
WP_054241944.1.46933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]