SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N1ICU4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N1ICU4
Domain Number 1 Region: 57-119
Classification Level Classification E-value
Superfamily RNA polymerase subunit RPB10 1.01e-28
Family RNA polymerase subunit RPB10 0.000071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0N1ICU4
Sequence length 123
Comment (tr|A0A0N1ICU4|A0A0N1ICU4_PAPMA) DNA-directed RNA polymerases I, II, and III subunit RPABC5 {ECO:0000313|EMBL:KPJ10847.1} KW=Complete proteome; Reference proteome OX=76193 OS=Papilio machaon (Old World swallowtail butterfly). GN=RR48_02979 OC=Papilionoidea; Papilionidae; Papilioninae; Papilio.
Sequence
MPTLGIAWIVGTDIHKATSVRWNFVLSLYTIFSKELELRLQPPNAINQCIRVIVFKMIIP
VRCFTCGKVIGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLGHVDLIEKLLNYAP
LEK
Download sequence
Identical sequences A0A0N1ICU4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]