SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N1K0F9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N1K0F9
Domain Number 1 Region: 57-105
Classification Level Classification E-value
Superfamily Cyclophilin-like 0.00000000375
Family PH0987 C-terminal domain-like 0.0011
Further Details:      
 
Domain Number 2 Region: 1-62
Classification Level Classification E-value
Superfamily PH0987 N-terminal domain-like 0.00000209
Family PH0987 N-terminal domain-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0N1K0F9
Sequence length 105
Comment (tr|A0A0N1K0F9|A0A0N1K0F9_THEVU) Allophanate hydrolase {ECO:0000313|EMBL:KPC68124.1} KW=Complete proteome; Reference proteome OX=2026 OS=Thermoactinomyces vulgaris. GN=ADL26_20500 OC=Thermoactinomyces.
Sequence
ALYRALEESPPPGVEDLVPAARTVLLRLAPGADPVRVEQAVRGLEPGEARAGTGELVRIP
VVYDGEDLPGVAELTGLPVREVVRLHISPIWTVAFGGFAPGFGYL
Download sequence
Identical sequences A0A0N1K0F9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]