SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N1KJJ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N1KJJ9
Domain Number 1 Region: 6-122
Classification Level Classification E-value
Superfamily YdhG-like 2.49e-17
Family YdhG-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0N1KJJ9
Sequence length 139
Comment (tr|A0A0N1KJJ9|A0A0N1KJJ9_9BURK) Uncharacterized protein {ECO:0000313|EMBL:KPD16337.1} KW=Complete proteome; Reference proteome OX=1682204 OS=Burkholderia sp. ST111. GN=ADM96_26905 OC=Burkholderiaceae; Burkholderia.
Sequence
MTPSENIDQLIAGITDWRGKTFASIRKTILEADPEIIEEWKWMGSPVWSRDGMIAVANAH
KGKVKLTFAHGANLADPDKLFNAGLDGNARRAIDFLEGDKVNGPALKKLVRAAIEYNQTK
LKKNAPASTRAKAHKAKEA
Download sequence
Identical sequences A0A0N1KJJ9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]