SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N1P2M3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N1P2M3
Domain Number 1 Region: 362-495
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000000968
Family Pseudo ankyrin repeat 0.025
Further Details:      
 
Domain Number 2 Region: 28-172
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00000000654
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N1P2M3
Sequence length 581
Comment (tr|A0A0N1P2M3|A0A0N1P2M3_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KPI45830.1} KW=Complete proteome; Reference proteome OX=1664694 OS=Phialophora attae. GN=AB675_850 OC=Phialophora.
Sequence
MGRLPHHASRRSSRRRVNLLVFLTEGIGPDVLPFLLQNADLNVRVVADTSKQDFAQYMEP
GISLEQLEWYENSPQDPYRNQNKMQGHRLARWADLLFMLSDAGMTSLMLGGFTTDVILHV
LRCWNSSKRIIMLPELSQDEWKHPIWERQMMKLQRDSDWIHLLQPALWNFSDQPTGVSQP
GPSPMGGEPDIDWHWEGPGDILEAIHSEVQSVLRKHASKPVVVSGPSNNQDDEDKARLPP
EVWTVILDHLGDWELATALGIYHHIPTPSEWSGLVPRSGAKTHSLEYTILTQPLSRIRAY
FTTSASYKPPTTLSQIATRLIFRFSMTKLLTYLALQQKDIFWTSFGLSLLPHKASLIYNS
PAILQWWKDCPAVIKKEYGPEALDGASRAGFVEVLQWWIDSGLHLSYTEKALESASAKGH
VEVLDWWKTNSEKLQNTSRDLPLKVGKSIILAAQSGRVESIEWWENSGIPYSHEDGVTRL
ASQHGHVAVLETWYNFKGSKMIFDNQVLVGATKNGHAGVLQWWKEVSKRSGLKVEYKTCD
IEEAMEDAVGGGGEGEVREWWGRNGLNLGVGTGEWMKVKTL
Download sequence
Identical sequences A0A0N1P2M3
XP_018005793.1.2460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]