SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N2QP64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N2QP64
Domain Number 1 Region: 47-226
Classification Level Classification E-value
Superfamily VC0467-like 7.59e-57
Family VC0467-like 0.00000645
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0N2QP64
Sequence length 226
Comment (tr|A0A0N2QP64|A0A0N2QP64_BORPT) UPF0301 protein L548_3743 {ECO:0000256|HAMAP-Rule:MF_00758} KW=Complete proteome OX=1331266 OS=Bordetella pertussis H921. GN=L548_3743 OC=Alcaligenaceae; Bordetella.
Sequence
MMAAPVAAFAGLPRLSRLPATKGAAMTDSHRPDADDIPDDDELSTDFSNQFLLAMPGVVE
GSLAGTVIYICEHTRRGALGLVINRPTDLTLATLFERIDLKLEIGPVKDEMVFFGGPVQT
DRGFVLHAPAGDYTSSINLGELALTTSRDVLQAVADGNGPARMLVTLGYAGWGAGQLESE
MAQNSWLSVGADSHIIFDVAPEDRYPAALKLLGVDPVMLAGGAGHA
Download sequence
Identical sequences A0A0N2QP64

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]