SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N4TDE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N4TDE1
Domain Number 1 Region: 42-119
Classification Level Classification E-value
Superfamily Moesin tail domain 1.31e-16
Family Moesin tail domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0N4TDE1
Sequence length 141
Comment (tr|A0A0N4TDE1|A0A0N4TDE1_BRUPA) Uncharacterized protein {ECO:0000313|WBParaSite:BPAG_0000622901-mRNA-1} KW=Complete proteome; Reference proteome OX=6280 OS=Brugia pahangi (Filarial nematode worm). GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Brugia.
Sequence
MQYLDDDPNFTATVAPIIKTQPSLFMKKQALLNGPPPDPSSNQMTPNDLLSLRTEIEKSR
ADYNEKKKSLQERMTEFRNEIESLKVVDRQSEHDRIHAANLQLGIDKYSTLRKSVPESYT
YHIYKSGAGATKTRVQVFDGL
Download sequence
Identical sequences A0A0N4TDE1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]