SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N4TTA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N4TTA9
Domain Number 1 Region: 110-218
Classification Level Classification E-value
Superfamily SH2 domain 5.25e-26
Family SH2 domain 0.0000123
Further Details:      
 
Domain Number 2 Region: 221-262
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000235
Family SOCS box-like 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0N4TTA9
Sequence length 295
Comment (tr|A0A0N4TTA9|A0A0N4TTA9_BRUPA) Uncharacterized protein {ECO:0000313|WBParaSite:BPAG_0001196801-mRNA-1} KW=Complete proteome; Reference proteome OX=6280 OS=Brugia pahangi (Filarial nematode worm). GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Brugia.
Sequence
MEAYSKRGRTIVRRIHMALLSCLPVNIIDNERLNVNEETGMNVELREIIVPSEVYPQQSV
QATRNCRLRFLFASDIAAEQPEPATRTLLQMPKDEPYIVHTSVHYTNCLVPRLDLIIDSS
YYWGIMDRYEAEALLDNKPEGTFLLRDSAQSEYLFSVSFRRYKRTLHARIEQKNHRFSFD
FSDPSIYSANTITKLISYYKDPTKCLFFEPQLSVPLPRNFVFSLQHLCRARIASLTTYDG
VEKLNLPVSLKNFIKEYHYKHPVKTVNYTPDTDLLHAYTLSSVEAMVTGANSAPS
Download sequence
Identical sequences A0A0J9Y9M5 A0A0N4TTA9
Bm8702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]