SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N4V4U7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N4V4U7
Domain Number 1 Region: 36-119
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.03e-26
Family Frizzled cysteine-rich domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N4V4U7
Sequence length 122
Comment (tr|A0A0N4V4U7|A0A0N4V4U7_ENTVE) Uncharacterized protein {ECO:0000313|WBParaSite:EVEC_0000519701-mRNA-1} KW=Complete proteome; Reference proteome OX=51028 OS=Enterobius vermicularis (Human pinworm). GN= OC=Oxyuroidea; Oxyuridae; Enterobius.
Sequence
MTFLVLLWLLLFPADCNPYVSDSFVMYSSDRPSANKCIPIPKNFTLCYGMQYTTMRLPNL
LEHETLDEVIEQAEPWPVLTNLNCHPDAQLFLCSLFAPVCLASLDREILPCRSLCEAVQK
VN
Download sequence
Identical sequences A0A0N4V4U7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]