SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N4VLD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N4VLD4
Domain Number 1 Region: 12-52
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000523
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0N4VLD4
Sequence length 76
Comment (tr|A0A0N4VLD4|A0A0N4VLD4_ENTVE) Uncharacterized protein {ECO:0000313|WBParaSite:EVEC_0001170201-mRNA-1} KW=Complete proteome; Reference proteome OX=51028 OS=Enterobius vermicularis (Human pinworm). GN= OC=Oxyuroidea; Oxyuridae; Enterobius.
Sequence
MMEGTEKRAGEAIQIPDGLRPLLEAFAKETLKSHPDDLVYFGKVFFDELYNLKESKWLMP
KFHSKFLIMLFHGLLE
Download sequence
Identical sequences A0A0N4VLD4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]