SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N4W0L7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N4W0L7
Domain Number 1 Region: 10-119
Classification Level Classification E-value
Superfamily ENTH/VHS domain 5.89e-20
Family VHS domain 0.00019
Further Details:      
 
Domain Number 2 Region: 150-269
Classification Level Classification E-value
Superfamily GAT-like domain 1.08e-16
Family GAT domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0N4W0L7
Sequence length 317
Comment (tr|A0A0N4W0L7|A0A0N4W0L7_HAEPC) Uncharacterized protein {ECO:0000313|WBParaSite:HPLM_0000311101-mRNA-1} KW=Complete proteome; Reference proteome OX=6290 OS=Haemonchus placei (Barber's pole worm). GN= OC=Haemonchus.
Sequence
MVEQNETERPIEYWISRSTDPFIDAETRKQYVQKLCDRVNYEADGAMVATGILGHKIVSP
DQDEALYSLQAVDQLVRKCGEKVHNRVGKFRFLNQIVKLITPKYLGAQTSPEVYDSLREH
NLITADPVIPEDEIMVVQLTTPKLAVFEDEEKARLLKELLNSTNPEDLQAANRLIQTLVK
SEDQKIERRHKRADELDHARQLCKRLEEAMMEKTAECLGITPDIIYTEAKMKTLADELMT
VRPHLFRFASDATENDEEALAEILAVNDQTLSWELPTKEAVEVTEESESGPLWETVNNTN
DVRSKMEMPLSYKQDMW
Download sequence
Identical sequences A0A0N4W0L7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]