SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N4W600 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N4W600
Domain Number 1 Region: 18-245
Classification Level Classification E-value
Superfamily Bactericidal permeability-increasing protein, BPI 7.85e-28
Family Bactericidal permeability-increasing protein, BPI 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N4W600
Sequence length 254
Comment (tr|A0A0N4W600|A0A0N4W600_HAEPC) Uncharacterized protein {ECO:0000313|WBParaSite:HPLM_0000543701-mRNA-1} KW=Complete proteome; Reference proteome OX=6290 OS=Haemonchus placei (Barber's pole worm). GN= OC=Haemonchus.
Sequence
MSGLVTSTKSSKLYFDYSATNEVSPYHPPFPFRLPQNTQRRMAEIAISEYTVNSLLYHAH
RTNSLLFHADSHTPGLGNILKTTCTVDEVCLSDQVEEIGKAYPGQRLEIIIRTTQPPTVR
FYQDEARLSLDGRCLFFLEGTRRKIGVIPFSIEALIRLQTVGSVLKGRITITKFSFNRGA
DFFGLSVEDLDGLRKTTKTAIENMTNGILGNGIPLSASNIVSSLRLSAIHVSVAPGAALL
QANVDLYSSFYNHS
Download sequence
Identical sequences A0A0N4W600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]