SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N4WJJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N4WJJ1
Domain Number 1 Region: 28-138
Classification Level Classification E-value
Superfamily Hypothetical protein c14orf129, hspc210 5.75e-37
Family Hypothetical protein c14orf129, hspc210 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0N4WJJ1
Sequence length 144
Comment (tr|A0A0N4WJJ1|A0A0N4WJJ1_HAEPC) Uncharacterized protein {ECO:0000313|WBParaSite:HPLM_0001118501-mRNA-1} KW=Complete proteome; Reference proteome OX=6290 OS=Haemonchus placei (Barber's pole worm). GN= OC=Haemonchus.
Sequence
MSTINRSLAGTPRNGSAIGSTIDLGGPHGTSSLELEAIAAVHELSYAVQSMSVSEMLPRT
SDMIFVNLTTMEGQPYCLELTHKGWRITSLRTDCMIGDFTRIELFTKYYDSPYELMDAIS
PGYRERFGEKLAQRLKMMEVGASQ
Download sequence
Identical sequences A0A0N4WJJ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]