SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N4XJV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N4XJV3
Domain Number 1 Region: 6-67
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000379
Family Pseudo ankyrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0N4XJV3
Sequence length 68
Comment (tr|A0A0N4XJV3|A0A0N4XJV3_NIPBR) Uncharacterized protein {ECO:0000313|WBParaSite:NBR_0000280501-mRNA-1} KW=Complete proteome; Reference proteome OX=27835 OS=Nippostrongylus brasiliensis (Rat hookworm). GN= OC=Nippostrongylus.
Sequence
MVASSLLIAAENGGIRELTELSIVRGFPNLRNKQKETAAHVAAGAGRIEALSFLTVKGAQ
LSMQDERG
Download sequence
Identical sequences A0A0N4XJV3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]