SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N4Y4U1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N4Y4U1
Domain Number 1 Region: 5-132
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.93e-43
Family Calponin-homology domain, CH-domain 0.00000249
Further Details:      
 
Domain Number 2 Region: 243-304
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 5.49e-18
Family EB1 dimerisation domain-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N4Y4U1
Sequence length 313
Comment (tr|A0A0N4Y4U1|A0A0N4Y4U1_NIPBR) Uncharacterized protein {ECO:0000313|WBParaSite:NBR_0001094601-mRNA-1} KW=Complete proteome; Reference proteome OX=27835 OS=Nippostrongylus brasiliensis (Rat hookworm). GN= OC=Nippostrongylus.
Sequence
MAAVVNVYATSATTENLSRHEMLMWVNDCLQSNFSKIEQLHTGAGYAQFTDFLFPGSIPL
KKVKWNSHLELDWLGNWKIVQTSWKSLGVEKVVPVDRLIKGKFQDNFEFLQWFKKFFDAN
YDGHEYNPVEARGGEPLPADAPAGKGPAPGATRMQMPTRSNLSATKTGPPSRNSSSYTIN
STPAKPRPATANPTTAPRQPAAAPAKINNNVVQKPAPATAAGHRPAAAPSLDAMQLKQLK
EEVDDLTRQLGESDAVMNSLEKERDFYFNKLRQIEVVCQDNESIGTVEVARILEILYETE
EGFAPPDEDEEQQ
Download sequence
Identical sequences A0A0N4Y4U1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]