SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N4Z049 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N4Z049
Domain Number 1 Region: 137-260
Classification Level Classification E-value
Superfamily EF-hand 1.2e-35
Family Osteonectin 0.00063
Further Details:      
 
Domain Number 2 Region: 72-134
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000166
Family Ovomucoid domain III-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N4Z049
Sequence length 261
Comment (tr|A0A0N4Z049|A0A0N4Z049_PARTI) Uncharacterized protein {ECO:0000313|WBParaSite:PTRK_0000008200.1} KW=Complete proteome; Reference proteome OX=131310 OS=Parastrongyloides trichosuri (Possum-specific nematode worm). GN= OC=Parastrongyloides.
Sequence
MKFWLSFILLIVFLSYPILSEEAGDEIESLIDDIDANSDLNPRRSVKTNACEGHICGWGK
ECIDDGKGRPTCQCIRECPKTVDEKDMVCATNNQTFPSLCELYQQKCLCKQNKDQCHDVK
YSKIHLDYLGQCKEIEECTTNMMDQFGERMADWLFQVMKELKRRRELHGIEWEQLISEAE
GDNEKRHVYPVIWKFCDLDIKPHDKHVTHHELIPMTAFVIPMESCIKPFLESCDADQDRS
ISIVEWGKCLGLKDGEIQERC
Download sequence
Identical sequences A0A0N4Z049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]